Query Name: TonB E.c. Message-ID: <200106280205.aa07537@gremlin-relay.ics.uci.edu> Query Length: 243 Prediction: MIMTSMTLDLPRRFPWPTLLSVCIHGAVVAGLLYTSVHQVIELPAPAQPISVTMVTPADL CCCCCCCCCCCCCCCHHHHHHHHHHHHHHHHHHHHCHHHHHCCCCCCCCEEEEEECCCCC EPPQAVQPPPEPVVEPEPEPEPIPEPPKEAPVVIEKPKPKPKPKPKPVKKVQEQPKRDVK CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCEECCCCCCCCCCCCCCCCCCCCCCCCEC PVESRPASPFENTAPARLTSSTATAATSKPVTSVASGPRALSRNQPQYPARAQALRIEGQ CCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCCHHHHHHCCCCEE VKVKFDVTPDGRVDNVQILSAKPANMFEREVKNAMRRWRYEPGKPGSGIVVNILFKINGT EEEEEEECCCCCCCCEEEEECCCHHHHHHHHHHHHHHCCCCCCCCCCCCEEEEEEEECCC TEIQ EECC PSI-BLAST hits : 22 For an explanation of the formats see: http://promoter.ics.uci.edu/BRNN-PRED/explanation.html#output_formats SSpro2, SSpro8, ACCpro, CONpro can be found at: http://promoter.ics.uci.edu/BRNN-PRED/ Please cite: Baldi,P., Brunak,S., Frasconi,P., Pollastri,G., Soda,G. (1999). "Exploiting the past and the future in protein secondary structure prediction". Bioinformatics, 15:937-946. ftp://promoter.ics.uci.edu/Papers/1999_GTCB.ps.gz Or: Pollastri,G., Baldi,P., Fariselli,P., Casadio,R. (2001). "Improved Prediction of the Number of Residue Contacts in Proteins by Recurrent Neural Networks". Bioinformatics (ISMB2001 special issue), in press. ftp://promoter.ics.uci.edu/Papers/2001_ISMB.ps.gz Query served in 205 seconds
Latest update of content: June 28, 2001 Ralf Koebnik
| ||||||||||||||||||||||||